DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33689

DIOPT Version :9

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:130 Identity:27/130 - (20%)
Similarity:50/130 - (38%) Gaps:43/130 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KFLDLKVDLQNDSGESNLSIDIKTHQDIEDVQLVVDFGL-ETDKGNYSTLINRTLNFCKLMKQRN 106
            |::|:.|:|.      .|.||          .:.:.|.| ..|.|.....|:.|.:.||.::.: 
  Fly    51 KYVDVYVNLY------KLPID----------NITISFRLMRHDHGYKPFFIDYTFDGCKFLRNQ- 98

  Fly   107 SDPLVRAIYE--------------------DLLKHGTL----FKECPIRSGTYSL-TNYNVDEEM 146
            ..|:::..|:                    |.|..|.:    .|..|:.:|.|:: :|::.|..|
  Fly    99 KHPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYIPMINGDYAVYSNWSTDNIM 163

  Fly   147  146
              Fly   164  163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 16/85 (19%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.