DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33642

DIOPT Version :10

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster


Alignment Length:138 Identity:36/138 - (26%)
Similarity:71/138 - (51%) Gaps:10/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RSFKVILT--SIDFEANDKFLDLKVDLQNDSGESNLSIDIKTHQDIEDVQL--VVDFGLETDKGN 87
            |||::.:.  ::.::..|....:...:.|.:..|.::.::....|:||:.:  .:|| .:|....
  Fly    26 RSFRIKMNEFAVKYKMRDLIQHIDFRIVNLNNRSYVNGEMIVKSDVEDILMHTTMDF-WKTSNQK 89

  Fly    88 YSTLINRTLNFCKLMKQRNSDPLVRAIYEDLLK--HGTLFKECPIRSG-TYSLTNYNVDEEMLPS 149
            ...|.:..|:.|:.:|..:.:.|.:...:...|  ||.|  .||:|:. .|:|||:::||:.||.
  Fly    90 KIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNL--SCPLRTNFNYTLTNWHMDEKDLPP 152

  Fly   150 FLPEAKFR 157
            |:|...||
  Fly   153 FVPLGTFR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 24/74 (32%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:461928 25/83 (30%)

Return to query results.
Submit another query.