DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33642

DIOPT Version :9

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster


Alignment Length:138 Identity:36/138 - (26%)
Similarity:71/138 - (51%) Gaps:10/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RSFKVILT--SIDFEANDKFLDLKVDLQNDSGESNLSIDIKTHQDIEDVQL--VVDFGLETDKGN 87
            |||::.:.  ::.::..|....:...:.|.:..|.::.::....|:||:.:  .:|| .:|....
  Fly    26 RSFRIKMNEFAVKYKMRDLIQHIDFRIVNLNNRSYVNGEMIVKSDVEDILMHTTMDF-WKTSNQK 89

  Fly    88 YSTLINRTLNFCKLMKQRNSDPLVRAIYEDLLK--HGTLFKECPIRSG-TYSLTNYNVDEEMLPS 149
            ...|.:..|:.|:.:|..:.:.|.:...:...|  ||.|  .||:|:. .|:|||:::||:.||.
  Fly    90 KIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNL--SCPLRTNFNYTLTNWHMDEKDLPP 152

  Fly   150 FLPEAKFR 157
            |:|...||
  Fly   153 FVPLGTFR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 24/74 (32%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007613
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.