DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33137

DIOPT Version :9

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:128 Identity:29/128 - (22%)
Similarity:46/128 - (35%) Gaps:24/128 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KGNYST-----LINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTLFKECPIRS-----GTYSLTN 139
            |.:||.     |::..:|.|..:.:|:..|....|.:...........||.|.     |.|    
  Fly    66 KKDYSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAY---- 126

  Fly   140 YNVDEEMLPSFLPEAKFRFGMKI--------STDKGGMIVRSTIFGRIDKSKGFDNLKRFSLG 194
              ::|..||:..|...::|.:.|        |...||:|........|...|..:..:.||.|
  Fly   127 --LNESYLPNVFPLGFYKFNITIMENYITPPSAHVGGIIWYVQAMHAIQPKKKTNRDRGFSGG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 23/109 (21%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.