DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG13193

DIOPT Version :10

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:163 Identity:33/163 - (20%)
Similarity:71/163 - (43%) Gaps:36/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GAWRS---------FKVILTSIDF--EANDKFLDLKVDLQND---------SGESNLSIDIKTHQ 68
            |||..         .::.::::.|  ....||.::.|:...|         :.:..|::||..::
  Fly     6 GAWSPKSPQAHQDLIQIQISALRFGPTLRSKFTNISVECSKDYCSSIRGWLTAKGELNLDIHLNR 70

  Fly    69 DIEDVQLVVDFGLET---------DKGNYSTLINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTL 124
            .:::       ||.|         .|..|.||.:..::.||.:::.....|::....::.|:|.|
  Fly    71 TLKN-------GLRTTITLLQLIDGKDRYQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNL 128

  Fly   125 FKECPIRSGTYSLTNYNVDEEMLPSFLPEAKFR 157
            ...|||:..:|.:.|:.::...:|.:||...:|
  Fly   129 ADRCPIQPASYDVRNFQLENHSIPGYLPAGFYR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 18/71 (25%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 18/71 (25%)

Return to query results.
Submit another query.