powered by:
Protein Alignment CG14455 and CG13198
DIOPT Version :9
Sequence 1: | NP_649402.2 |
Gene: | CG14455 / 40480 |
FlyBaseID: | FBgn0037175 |
Length: | 194 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610690.1 |
Gene: | CG13198 / 36245 |
FlyBaseID: | FBgn0033640 |
Length: | 180 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 17/64 - (26%) |
Similarity: | 30/64 - (46%) |
Gaps: | 1/64 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 NFCKLMKQRNSD-PLVRAIYEDLLKHGTLFKECPIRSGTYSLTNYNVDEEMLPSFLPEAKFRFG 159
:|||||..||.| ...|.|::.:.|.....:.||.:....::..:.:|...:...:|...:|.|
Fly 96 DFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENHMTVEKFALDFTKISMPVPAGTYRLG 159
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14455 | NP_649402.2 |
DM8 |
87..179 |
CDD:214778 |
17/64 (27%) |
CG13198 | NP_610690.1 |
DM8 |
86..179 |
CDD:214778 |
17/64 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45448106 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.