DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33483

DIOPT Version :10

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:158 Identity:31/158 - (19%)
Similarity:57/158 - (36%) Gaps:38/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RSFKVILTSIDFEANDKFLDLKV---DLQNDSGE-----------SNLSIDIKTHQDIEDVQLVV 77
            |.:|:.:|.:...:..:|.::|.   |...|..|           ..||:.:..|: :...::.|
  Fly    60 RMYKIPVTKVKIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHK-VPITKVKV 123

  Fly    78 DFGLETDKGNYST-LINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTLFKECPIRSGTYSLTNYN 141
            :|.|......|.. |.|.|::.||.::....:|:....|.....|..:...||.           
  Fly   124 NFSLLKRFNGYKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPF----------- 177

  Fly   142 VDEEMLPSFLP----------EAKFRFG 159
             |.:::...||          :.||..|
  Fly   178 -DHDLIVEKLPTNFMNQKVNGDIKFPHG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 17/84 (20%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:461928 20/94 (21%)

Return to query results.
Submit another query.