DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14457 and CG14259

DIOPT Version :9

Sequence 1:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651532.1 Gene:CG14259 / 43261 FlyBaseID:FBgn0039483 Length:289 Species:Drosophila melanogaster


Alignment Length:248 Identity:116/248 - (46%)
Similarity:166/248 - (66%) Gaps:5/248 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FLKEPPDYIKECRIADKDFVNCSTHSIQQLFDKLNDGIPG-LTSIRSFDPFYLNRIRITQGNSNA 87
            :..|.|.::..|||.:..|..|||:|||:|.|:||.|||. |.....|||..:..|...|.|:..
  Fly    38 YYSEKPAFLPSCRIYEPGFTKCSTNSIQKLLDQLNIGIPEVLERFGPFDPMRVRDIVFKQDNNEV 102

  Fly    88 INLKVELANVKIIGFGHTNVLDSQVFKKDYSWKTTFTLPEMKLQADYSLFGRILLIPLNGKGQVF 152
            ..::..|.::.:.||.:|.|.:|:|.|||:||:|...||:|:|...|.:.||||||||:|.|::|
  Fly   103 ATIRANLTDLVVKGFANTKVKESRVSKKDFSWQTKIYLPKMRLDGRYEMAGRILLIPLSGSGKIF 167

  Fly   153 LDAENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKSYFSNLFNG-NKQLEDSTNKFFNDN 216
            ::.:::.:.:.||.|||.||||||.|||.:.|...:..:::|..||||| :|::|.|||:|||:|
  Fly   168 IEIDDLDILLLTKIRLYEKGGFTFDNVTAVQVQLNLSKVRTYLDNLFNGRSKEVERSTNEFFNEN 232

  Fly   217 WRMLADALYTVITQTIEDILLDVLKKIFHFIPANFFVSDIPTPEQLYGRAKPK 269
            ||...:||..:|.:|:|:||.||:..:||.|||||||.|||||:||||   ||
  Fly   233 WRDFYEALKPLIVETVENILYDVMSTVFHLIPANFFVEDIPTPQQLYG---PK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 103/230 (45%)
CG14259NP_651532.1 JHBP 32..269 CDD:284096 103/230 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470318
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 1 1.000 - - H81354
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27175
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012742
OrthoInspector 1 1.000 - - otm49832
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.