DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14457 and CG14258

DIOPT Version :9

Sequence 1:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651531.1 Gene:CG14258 / 43260 FlyBaseID:FBgn0039482 Length:258 Species:Drosophila melanogaster


Alignment Length:255 Identity:83/255 - (32%)
Similarity:140/255 - (54%) Gaps:9/255 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVLLVTFTTCLVRAEDG--FLKEPPDYIKECRIADKDFVNCSTHSIQQLFDKLNDGIPGLTSIRS 69
            :...::....|:.|.:|  :|.|.||::..|.:.|.:|..|.|.:.|..|.:..|||||..::.|
  Fly     5 VAKFLSIVAVLLSAVEGAKYLAEKPDFLIPCIVGDPNFNVCLTKNFQSFFRQWKDGIPGYNAVGS 69

  Fly    70 FDPFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNVLDSQVFKKDYSWKTTFTLPEMKLQADY 134
            |||||:.|::.||..|.:|.:..:|..|.:.|.|...||:|......|..:|..::|:::...||
  Fly    70 FDPFYIKRVKFTQDASRSIAINADLKEVYVAGAGQALVLESSWDPNHYVARTLISVPKLRFNFDY 134

  Fly   135 SLFGRILLIPLNGKGQVFLDAENMTVTMHTKTR-LYSKGGFTFYNVTNLHVDFKMDGLKSY---F 195
            .:.|.:..:.|||.|:.:.:|||..:.:....: |.:..|: |.:|.::.|:|:  .:|.:   .
  Fly   135 KVKGHVSALNLNGHGKGYFEAENALLLLELAVKPLATSDGY-FADVQSVKVNFR--EIKQFRIKL 196

  Fly   196 SNLFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIFHFIPANFFVSD 255
            .|||.|||.|||:.:..||:|||...:.|...:.||:..:|||..||.|.::||.:.:.|
  Fly   197 ENLFGGNKDLEDTAHILFNENWRDFFEVLRPAVEQTVGGVLLDRFKKTFVYVPATYLIKD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 82/251 (33%)
CG14258NP_651531.1 JHBP 13..255 CDD:284096 82/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470322
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012742
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.