DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14457 and CG11854

DIOPT Version :9

Sequence 1:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651358.4 Gene:CG11854 / 43037 FlyBaseID:FBgn0039299 Length:250 Species:Drosophila melanogaster


Alignment Length:272 Identity:70/272 - (25%)
Similarity:117/272 - (43%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LELIVLLVTFTTCLVRAEDGFLKEPPDYIKECRIADKDFVNCSTHSIQQLFDKLN--------DG 60
            :||.:.||....|  .:..|...:.|..|:.|.|.|:          |.|.|::|        .|
  Fly     1 MELTLALVLLFGC--ASTYGHASDFPSGIERCAIMDE----------QCLEDRVNFVLRNYAKSG 53

  Fly    61 IPGLTSIRSFDPFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNVLDS-QVFKKDY--SWKTT 122
            |..|..| ..||.::.:.:|.:...:.:|:.:....:.|:|. |..|... ..|.:|.  |.:..
  Fly    54 IKELGLI-PLDPLHVKKFKIGRNPHSPVNIDLSFHEMDILGL-HQGVAKRVSGFTRDLSRSIELV 116

  Fly   123 FTLPEMKLQADYSLFGRILLIPLNGKGQVFLDAENMTVTMHTKTRLYSKGGF-TFYNVTNLHVDF 186
            ..:||:.::..||:.||||::|:.|.|...:......|....|.:..|||.. |:..|.|:.|:.
  Fly   117 MEVPEIGVRGPYSVDGRILILPITGNGIADIRLTRTKVRAQIKLKRVSKGDHQTYAEVMNIKVEL 181

  Fly   187 KMDGLKSYFSNLFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIFHFIPANF 251
            ....:.....|||||.|.|.::.:...|:||:.:.:.|...|.:....|...|:.:||..:|.  
  Fly   182 DPSHVTYQLENLFNGQKDLSENMHALINENWKDIFNELKPGIGEAFGLIAKSVVDRIFGKLPL-- 244

  Fly   252 FVSDIPTPEQLY 263
                    |||:
  Fly   245 --------EQLF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 66/258 (26%)
CG11854NP_651358.4 JHBP 21..249 CDD:214779 64/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.