DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14457 and CG11852

DIOPT Version :9

Sequence 1:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster


Alignment Length:246 Identity:65/246 - (26%)
Similarity:108/246 - (43%) Gaps:28/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VTFTTCLVRAEDGFLKEPPDYIKECRIADKD-FVNCSTHSIQQLFDKLNDGIPGLTSIRSFDPFY 74
            |....|||.....|   ||: :..|.:.|.. .:|.|...|:|   ....|.|. ......:||.
  Fly     9 VALFCCLVSGASNF---PPE-LPRCHMGDTSCIINVSHMLIRQ---HARTGYPS-AGFPQVEPFL 65

  Fly    75 LNRIRITQGNSNAINLKVELANVKI-----------IGFGHTNVLDSQVFKKDYSWKTTFTLPEM 128
            :.|..|:.|.:.::|||:...:|.:           :|||    .|....|    ::...:.|::
  Fly    66 IKRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDRAVGFG----ADPATSK----FEMYGSFPKI 122

  Fly   129 KLQADYSLFGRILLIPLNGKGQVFLDAENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKS 193
            .|:..|...||||::|:.|.|...:...|...::..|.....:.|.|:.:|..|.|..:...:..
  Fly   123 VLKGKYVADGRILILPIRGDGDAEIVLHNPKFSVKFKPGTQQRNGRTYLSVDKLKVLVEPQKMNI 187

  Fly   194 YFSNLFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIF 244
            ...|||||::.|..:.|:|.||||..:.:.|:..|...|.:|:..||.::|
  Fly   188 RLENLFNGDQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 65/246 (26%)
CG11852NP_651357.1 JHBP 9..248 CDD:284096 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470359
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.