DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14457 and CG15497

DIOPT Version :9

Sequence 1:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster


Alignment Length:232 Identity:51/232 - (21%)
Similarity:103/232 - (44%) Gaps:30/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 CRIADKDFVNCSTHSIQQLFDKL----NDGIPGLTSIRSFDPFYLNRIRITQGNSNAI-NLKVEL 94
            |..:|:||..|    ::|:|:.|    ..|:|.. :|:.|||.:.:.:.:.:|.|..: :.::.|
  Fly    46 CHWSDEDFNEC----MRQVFNDLRAYFTTGVPDY-NIKPFDPHHCSYVELRRGESQGLGSFRLIL 105

  Fly    95 ANVKIIGFGHTNVLDSQVFKKDYSWKTTFTLPEMKLQADYSLFGRILLIPLNGKGQVFLDAENMT 159
            .||...|:..:.|.......:|.....|...|:..|:.:|....::|...:|.||.     .|:|
  Fly   106 RNVSEYGWARSEVTKFHADPEDQRIVYTQYFPDKSLEGEYEFAAKMLGTEMNRKGH-----WNLT 165

  Fly   160 VTMHTKT----RLYSKGGFTFYNVTNLHVDF-KMDGLKSYFSNLFNGN--KQLEDSTNKFFNDNW 217
            :..:::|    |:...|     ::..:||:. ::.|::.:..||..|.  .||.|..   .|..|
  Fly   166 LYDYSQTTSVRRIGGPG-----SLIKVHVEVDRIGGMELHIENLLQGQPLNQLADGV---INSMW 222

  Fly   218 RMLADALYTVITQTIEDILLDVLKKIFHFIPANFFVS 254
            ::....:..:|.:.:.....|:..:.|...|...|::
  Fly   223 QLGLPFIKPMINELVSTAFTDIFNESFRHFPLEKFLA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 50/229 (22%)
CG15497NP_650976.1 JHBP 26..258 CDD:284096 50/229 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470604
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.