DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14457 and CG7079

DIOPT Version :9

Sequence 1:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:255 Identity:57/255 - (22%)
Similarity:96/255 - (37%) Gaps:49/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PDYIKECRIADKDFVNCSTHSIQQLFDKLNDGIP-------GLTSIRSF----DP------FYLN 76
            |..:|:|...|.   .|...|...|......|||       .:.|:|.:    |.      :|.|
  Fly    23 PAKVKKCHFGDG---KCLVESANALLRDFPKGIPEVDLKPFNVLSVRDWLLVNDSQVGGAWYYFN 84

  Fly    77 RIRITQGNSNAINLKVELANVKIIGFGHTNVLDSQVFKKDYSWKTTF------TLPEMKLQADYS 135
            .|       |.||          .||.:|.:.:.:.|.||   .||.      .:|.:..:.||.
  Fly    85 LI-------NQIN----------YGFENTTITEIRGFDKD---PTTTKIEIHGKIPRLVYKGDYV 129

  Fly   136 LFGRIL-LIPLNGKGQVFLDAENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKSYFSNLF 199
            ..||:| .:.::.:|....|..|....:..|.|:..:....:..:..|..:.::|....:..|.|
  Fly   130 AKGRMLWFVDIHSQGTSESDFLNFQFVLTLKVRVEYRNNKRYLKIYELVPNIRLDRWIMWLDNFF 194

  Fly   200 NGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIFHFIPAN--FFVSDIP 257
            ..|:.|..:.|..||.||....:.|...|.:..|.:.|.:.:.:|..:|.:  |..::.|
  Fly   195 PDNEDLTIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYDDLFLAAEDP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 56/249 (22%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 55/248 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.