DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14457 and CG31189

DIOPT Version :9

Sequence 1:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster


Alignment Length:245 Identity:53/245 - (21%)
Similarity:94/245 - (38%) Gaps:43/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PDYIKECRIADKDFVNCSTHSIQQLFDKLNDGIP--GLTSIRSFD-------------PFYLN-- 76
            |:.:::|...|.   .|...||..|......|||  ||..:.:::             |.:::  
  Fly    24 PEDVEKCHFGDS---TCLVRSINALIKHYPKGIPEIGLPPLDAYNFPDSVIMESPSRGPIWMDFR 85

  Fly    77 -RIRITQGNSNAINLKVELANVKIIGFGHTNVLDSQVFKKDYSWKTTFTLPEMKLQADYSLFGRI 140
             |..:.:|.:||....||       ||.:.......|.|        ..||.:..:|.|.:.||:
  Fly    86 MRDNVNKGFNNATITHVE-------GFLYEPNQKQIVLK--------VRLPRLVHEATYDMSGRV 135

  Fly   141 LLIPLNGKGQVFLDAENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKSYFSNLFNGNKQL 205
            ||...|..|::..|.:|..:|:..|..:..:....:..:.||.....:|....:...|:..|..:
  Fly   136 LLFFFNTTGRLISDFQNFRITLTIKALVEYRNDKRYLKIYNLVPSLDLDRWIIWLDGLYKENTDV 200

  Fly   206 EDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIFH-------FIP 248
            ....||.||:||....:.|...:.:...:....:|.::|.       |:|
  Fly   201 TIFMNKLFNENWVEFWNDLQPGLVKAFTNAFTVLLNRVFDNVAYDDMFLP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 53/245 (22%)
CG31189NP_732580.3 JHBP 9..249 CDD:284096 51/242 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470379
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.