DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14457 and CG16820

DIOPT Version :9

Sequence 1:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_609627.1 Gene:CG16820 / 34730 FlyBaseID:FBgn0032495 Length:309 Species:Drosophila melanogaster


Alignment Length:247 Identity:49/247 - (19%)
Similarity:95/247 - (38%) Gaps:49/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IKECRIADKDFVNCSTHSIQQLFDKLN-DGIPGLTSIRSFDPFYLNRIRITQGNSNAINLKVELA 95
            :..|.:...|...|....||....||. .|:|.. ::.|.||::..| .|.:..::.|...:.:.
  Fly    85 VTPCSLNSPDLNECIRGLIQSFAPKLRYQGVPEF-NMDSIDPYFYKR-GIFRYTNDGIQGGLLIK 147

  Fly    96 NVKIIGFG--HTNVLDSQVFKKDYSWKTTFTLPEMK----LQADYSLFGRILLIPLNGKGQVFLD 154
            |::|.|..  ..|.:.:......:..|....||::|    .:||.. ||.:.|:|   ||...:.
  Fly   148 NMEIYGISQLQVNSVAANFTDNGFIIKLGVELPQLKAGGHFKADVK-FGGLRLVP---KGPFNIT 208

  Fly   155 AENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKSYFSNLFNGNKQLEDS---TNKFFNDN 216
            .:|:..|:                :|:.|::....|.:....:..|.|..:.|:   .|..|:| 
  Fly   209 IDNIKATI----------------LTDGHIEQLPSGQQRLSLHRLNANVNIGDAKVVANGIFSD- 256

  Fly   217 WRMLADALYTVITQTIED---------------ILLDVLKKIFHFIPANFFV 253
             |.|...:..::.:.:.:               ||:..:.:.|..:|...|:
  Fly   257 -RNLNAMILNLVNENLPEITRVGIPATREQWAPILIAHINEFFAKVPIEKFL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 48/245 (20%)
CG16820NP_609627.1 JHBP 79..308 CDD:214779 49/247 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.