DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14457 and CG5867

DIOPT Version :9

Sequence 1:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_609625.2 Gene:CG5867 / 34728 FlyBaseID:FBgn0027586 Length:262 Species:Drosophila melanogaster


Alignment Length:269 Identity:67/269 - (24%)
Similarity:114/269 - (42%) Gaps:24/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARLELIVLLVTFTTCLVRAEDGF-------LKEPPDYIKECRIADKDFVNCSTHSIQQLFDKLN 58
            |.|:..:|.|:......:.||...       ::|.|..|..||..|.:...|....:||:..::.
  Fly     1 MGRIFGVVALILMAGLCLAAEIELPPVEFKPVREIPGDIPTCREGDINISECIKQGLQQITPRMK 65

  Fly    59 DGIPGLTSIRSFDPFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNVLDSQVFK-KD--YSWK 120
            .||..| :|...|||.:.:...:. .|..:..::.:.||.|.|... .::|...|: ||  ...:
  Fly    66 YGISEL-NIPPLDPFEMGKSSYSY-TSGLLQGRISMKNVVIHGLSE-GIVDKVNFRLKDGRVRME 127

  Fly   121 TTFTLPEMKLQADYSLFGRILLIPLNGKGQVFLDAENMTVT---MHTKT--RLYSKGGFTFYNVT 180
            ....:|:|.::..|....::..:.||.||     |.|:|:|   |..:.  .||.:.|.|:..:|
  Fly   128 ILSHVPQMFVEGLYKADIKLNDLKLNPKG-----AFNITMTDVAMRARPIGELYERDGHTYLRLT 187

  Fly   181 NLHVDFKMDGLKSYFSNLFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIFH 245
            .|..:.|:..||.|.:.|. .:..|.|....|.|..||.|..|:......|.:.::|......|.
  Fly   188 KLETEPKVGDLKFYANGLV-PDPVLNDVILDFINQYWRQLYQAMLPETLDTWQPLILKSTNDFFA 251

  Fly   246 FIPANFFVS 254
            .:|.:..|:
  Fly   252 ALPFDMLVT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 64/261 (25%)
CG5867NP_609625.2 JHBP 34..260 CDD:214779 60/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.