DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14457 and CG31207

DIOPT Version :9

Sequence 1:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_732581.1 Gene:CG31207 / 326125 FlyBaseID:FBgn0051207 Length:258 Species:Drosophila melanogaster


Alignment Length:251 Identity:55/251 - (21%)
Similarity:91/251 - (36%) Gaps:39/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PDYIKECRIADKDFVNCSTHSIQQLFDKLNDGIP--GLTSIRSFD-------------PFYLNRI 78
            |..||:||..|.   .|..:|:..:......|||  ||..|...|             .|:||..
  Fly    23 PKEIKKCRFGDS---KCIVNSMNAIIKNYPKGIPAIGLKPIDVVDIRDSKFWNDAMVGAFWLNFD 84

  Fly    79 RITQGNSNAINLKVELANVKIIGFGHTNVLDSQVFKKDYSWKTTFTLPEMKLQADYSLFGRILLI 143
            ...|.|....|..:    .|:.||.. |...|.:       :....:|.:..:.||...||:.::
  Fly    85 LFNQVNYGFENTTI----TKVSGFDE-NPTSSLI-------EIHGRIPSLIHKGDYFSMGRVWIV 137

  Fly   144 PLNGKGQVFLDAENMTVTMHTKTRLYSKGGFTFYNVTNLHVDFKMDGLKSYFSNLFNGNKQLEDS 208
            .:|..|:...|.:|....:..|..:..:....:..:..|.....||....:..|.|..|..:..:
  Fly   138 QMNSTGESLSDFQNFRFVLKLKVIMEYRNNKRYLKIYELTPFVTMDRWVFWLDNFFESNTDMTIA 202

  Fly   209 TNKFFN----DNWRMLADALYTVITQTIEDILLDVLKKIFH---FIPAN--FFVSD 255
            .|:.||    :.|..|......:.......:..|:.||:.:   |:|.:  |.|:|
  Fly   203 INQVFNLHWVEFWNELEPTNLKIFAGVFRSVFEDIFKKVPYDDMFLPISKEFEVND 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 53/247 (21%)
CG31207NP_732581.1 JHBP 7..248 CDD:284096 50/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470364
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.