DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14457 and dyw

DIOPT Version :9

Sequence 1:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster


Alignment Length:254 Identity:68/254 - (26%)
Similarity:127/254 - (50%) Gaps:23/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVTFTTCLVRAEDGFLKEPPDYIKECRIADKDFVNCSTHSIQQLFDKLNDGIPGLTSIRSFDPFY 74
            |:::.:|.|.|.:||    |..:|.|::.|:   :|.....|..|....:|||. ..:.:.:|..
  Fly    15 LLSWVSCRVDASEGF----PSPLKRCKLQDE---SCLLAQAQTFFQAFKNGIPE-RQVAALEPIA 71

  Fly    75 LNRIRI-TQGNSNAINLKVELANVKIIGFGHTNVLDS-QVFKKDYSWKTTFTL----PEMKLQAD 133
            |..:.| :.|:|.:|..|:.:::.|:....::.::.| :.|.||.:.....||    ||::::|.
  Fly    72 LGTMFIESGGHSESIKFKLTMSDAKLYNLANSMMVKSLKGFTKDLTRPLKLTLLLDNPELEVRAK 136

  Fly   134 YSLFGRILLIPLNGKGQVFLDAENMTVTMHTKTRLYSK-----GGFTFYNVTNLHVDFKMDGLKS 193
            |.:.|::|::|:..||.:.:...:    :|||..:.::     .|.|:.|:|:.....|:.|...
  Fly   137 YDVDGKLLILPIVSKGDLTIRLND----VHTKVWITAEPVKRSDGHTYLNITDYKTATKIKGGHF 197

  Fly   194 YFSNLFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIFHFIPANFF 252
            ..|||||.||:|.|||.|..|..|..||..:...|.:........:::.::..||.:.|
  Fly   198 DLSNLFNDNKELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQSLWANIPYDEF 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 68/254 (27%)
dywNP_570016.1 JHBP 29..258 CDD:214779 63/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470406
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.