DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POTEG and Actc1

DIOPT Version :9

Sequence 1:NP_001005356.1 Gene:POTEG / 404785 HGNCID:33896 Length:508 Species:Homo sapiens
Sequence 2:NP_062056.1 Gene:Actc1 / 29275 RGDID:2026 Length:377 Species:Rattus norvegicus


Alignment Length:172 Identity:36/172 - (20%)
Similarity:62/172 - (36%) Gaps:31/172 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   226 LEHGTDPNIPDEYGNTALHYAIYNEDKLMAK--ALLLYGADIESK-NKHGLTPLLLGVHEQKQQV 287
            :|||...|..|.  ....|:..|||.::..:  ..||..|.:..| |:..:|.::..........
  Rat    73 IEHGIITNWDDM--EKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMY 135

Human   288 VKFLIKKKANLNALDRYGRTALILAVCCGSASIVSLL-------LEQNIDVSSQDLSG------- 338
            |  .|:...:|.|..|  .|.::|....|....|.:.       ....:|::.:||:.       
  Rat   136 V--AIQAVLSLYASGR--TTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILT 196

Human   339 -------QTAREYAVSSHHNVICQLLSDYKEKQMLKVSSENS 373
                   .||....|......:|.:..|: |.:|...:|.:|
  Rat   197 ERGYSFVTTAEREIVRDIKEKLCYVALDF-ENEMATAASSSS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POTEGNP_001005356.1 Ank_4 143..193 CDD:290365
ANK 167..292 CDD:238125 16/68 (24%)
ANK 1 172..201
ANK repeat 174..203 CDD:293786
Ank_2 177..269 CDD:289560 13/45 (29%)
ANK repeat 205..236 CDD:293786 4/9 (44%)
ANK 2 205..234 3/7 (43%)
ANK 233..357 CDD:238125 28/147 (19%)
ANK repeat 238..269 CDD:293786 8/33 (24%)
ANK 3 238..267 7/30 (23%)
Ank_2 243..335 CDD:289560 20/101 (20%)
ANK repeat 271..302 CDD:293786 5/30 (17%)
ANK 4 271..300 4/28 (14%)
ANK repeat 304..335 CDD:293786 5/37 (14%)
ANK 5 304..333 5/35 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..488 2/7 (29%)
Actc1NP_062056.1 PTZ00281 4..377 CDD:173506 36/172 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
HGNC 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100127
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.