DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.5AL and NDUFA7

DIOPT Version :9

Sequence 1:NP_649399.1 Gene:ND-B14.5AL / 40477 FlyBaseID:FBgn0037172 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_004992.2 Gene:NDUFA7 / 4701 HGNCID:7691 Length:113 Species:Homo sapiens


Alignment Length:101 Identity:34/101 - (33%)
Similarity:51/101 - (50%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSRVRNFLLGR--THKTAHRFADMVSPRTQPPPNIPSGPTQSLFANYYYTRDPRRLVKPFVDVVQ 76
            :.|:||:..|.  ..|...|:.: :|.||||||.:|.||:..|..|||.|||.||...|...::.
Human     8 IQRLRNWASGHDLQGKLQLRYQE-ISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIMS 71

  Fly    77 EHKKMLTAKVKEEEAAKKAQAKSGDAPKDGSPIPPV 112
            ..|.:::.|..|..|....:.|:      .:|.||:
Human    72 SQKALVSGKPAESSAVAATEKKA------VTPAPPI 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.5ALNP_649399.1 CI-B14_5a 13..98 CDD:284707 30/85 (35%)
NDUFA7NP_004992.2 CI-B14_5a 5..102 CDD:311349 34/101 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..51 11/18 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159574
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4630
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5262
Isobase 1 0.950 - 0 Normalized mean entropy S5028
OMA 1 1.010 - - QHG48369
OrthoDB 1 1.010 - - D1465659at2759
OrthoFinder 1 1.000 - - FOG0006420
OrthoInspector 1 1.000 - - otm40268
orthoMCL 1 0.900 - - OOG6_107400
Panther 1 1.100 - - O PTHR12485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4686
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.720

Return to query results.
Submit another query.