DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.5AL and ndufa7

DIOPT Version :9

Sequence 1:NP_649399.1 Gene:ND-B14.5AL / 40477 FlyBaseID:FBgn0037172 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001003436.1 Gene:ndufa7 / 445042 ZFINID:ZDB-GENE-040801-169 Length:104 Species:Danio rerio


Alignment Length:95 Identity:37/95 - (38%)
Similarity:50/95 - (52%) Gaps:7/95 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSRVRNFLLGR--THKTAHRFADMVSPRTQPPPNIPSGPTQSLFANYYYTRDPRR-LVKPFVDVV 75
            :.|:||:|.|:  ..|...|:.: |:.||||||.:|.||:.....|||.|||.|| :|.|  .|:
Zfish     8 IQRLRNYLSGQDLQSKLQLRYTE-VAKRTQPPPKLPVGPSHKFANNYYCTRDGRREMVPP--TVI 69

  Fly    76 QEHKKMLTAKVKEEEAAKKAQAKSGDAPKD 105
            ...:|.|||. .|.....|.|...|...|:
Zfish    70 MSSQKALTAG-SEASGKPKHQVVPGQQLKE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.5ALNP_649399.1 CI-B14_5a 13..98 CDD:284707 35/86 (41%)
ndufa7NP_001003436.1 CI-B14_5a 5..95 CDD:284707 36/90 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595769
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4630
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5215
OMA 1 1.010 - - QHG48369
OrthoDB 1 1.010 - - D1465659at2759
OrthoFinder 1 1.000 - - FOG0006420
OrthoInspector 1 1.000 - - otm26393
orthoMCL 1 0.900 - - OOG6_107400
Panther 1 1.100 - - O PTHR12485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4686
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.