DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trxr-2 and TRR2

DIOPT Version :9

Sequence 1:NP_524216.1 Gene:Trxr-2 / 40475 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_011974.1 Gene:TRR2 / 856506 SGDID:S000001148 Length:342 Species:Saccharomyces cerevisiae


Alignment Length:237 Identity:58/237 - (24%)
Similarity:100/237 - (42%) Gaps:54/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VTRVDLRDKKVEYVNSMATFRDSHTIEYVAMPGAEHRQVTSEYVVVAVGGRPRYPDIPGAV---E 197
            |::|||..|         .||........|.|      ||::.:::|.|...:...:||..   :
Yeast   110 VSKVDLSSK---------PFRLWTEFNEDAEP------VTTDAIILATGASAKRMHLPGEETYWQ 159

  Fly   198 LGITSDDIFS-----YEREPGRTLVVGAGYVGLECACFLKGLGYEPTVMVRSIVLRGFDRQMSEL 257
            .||::..:..     :..:|  ..|:|.|....|.|.||.....:..::||.      |...:.:
Yeast   160 QGISACAVCDGAVPIFRNKP--LAVIGGGDSACEEAEFLTKYASKVYILVRK------DHFRASV 216

  Fly   258 LAAMMTER--GIPFLGTTIPKAVERQADGRLL--VRYRNTTTQMDGSDVFDTVLWAIGR------ 312
            :.....|:  .|..|..|:  |:|.:.||:||  :|.:||.:.::.....:.:.:|||.      
Yeast   217 IMQRRIEKNPNIIVLFNTV--ALEAKGDGKLLNMLRIKNTKSNVENDLEVNGLFYAIGHSPATDI 279

  Fly   313 -KGLIEDLNLDAAG-VKTHDDKIVVDAAEATSVPHIFAVGDI 352
             ||.:::   :..| :||      |..:..||||..||.||:
Yeast   280 VKGQVDE---EETGYIKT------VPGSSLTSVPGFFAAGDV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358
TGR 31..515 CDD:273624 58/237 (24%)
NADB_Rossmann <144..239 CDD:304358 21/102 (21%)
Pyr_redox 214..288 CDD:278498 20/77 (26%)
Pyr_redox_dim 388..497 CDD:280934
TRR2NP_011974.1 TRX_reduct 28..338 CDD:273540 58/237 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.