DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trxr-2 and TRR1

DIOPT Version :9

Sequence 1:NP_524216.1 Gene:Trxr-2 / 40475 FlyBaseID:FBgn0037170 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_010640.1 Gene:TRR1 / 851955 SGDID:S000002761 Length:319 Species:Saccharomyces cerevisiae


Alignment Length:304 Identity:71/304 - (23%)
Similarity:118/304 - (38%) Gaps:74/304 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 GEAVHEAVAYGWNVDDTNIRP--------------DWRKLVRSVQNHIKSVNWVTRVDLRDKKVE 147
            |.|.|.|..|   :....|:|              ........::|.....:.:|..:|.|:..|
Yeast    12 GPAAHTAAIY---LARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTGSELMDRMRE 73

  Fly   148 YVNSMATFRDSHTIEYVAMP----------GAEHRQVTSEYVVVAVGGRPRYPDIPGAV---ELG 199
            ......|...:.|:..|.:.          ..:...||::.:::|.|...:...:||..   :.|
Yeast    74 QSTKFGTEIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKG 138

  Fly   200 ITSDDIFS-----YEREPGRTLVVGAGYVGLECACFLKGLGYEPTVMVRSIVLRGFDRQMSELLA 259
            |::..:..     :..:|  ..|:|.|....|.|.||...|.:..::||...||.         :
Yeast   139 ISACAVCDGAVPIFRNKP--LAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRA---------S 192

  Fly   260 AMMTERG-----IPFLGTTIPKAVERQADGRLL--VRYRNT----TTQMDGSDVFDTVLWAIGR- 312
            .:|.:|.     |..|..|:  |:|.:.||:||  :|.:||    .|.:..|.:|    :|||. 
Yeast   193 TIMQKRAEKNEKIEILYNTV--ALEAKGDGKLLNALRIKNTKKNEETDLPVSGLF----YAIGHT 251

  Fly   313 ---KGLIEDLNLDAAG-VKTHDDKIVVDAAEATSVPHIFAVGDI 352
               |.:...::.|.|| :||      |..:..||||..||.||:
Yeast   252 PATKIVAGQVDTDEAGYIKT------VPGSSLTSVPGFFAAGDV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trxr-2NP_524216.1 NADB_Rossmann 29..>68 CDD:304358
TGR 31..515 CDD:273624 71/304 (23%)
NADB_Rossmann <144..239 CDD:304358 21/112 (19%)
Pyr_redox 214..288 CDD:278498 23/80 (29%)
Pyr_redox_dim 388..497 CDD:280934
TRR1NP_010640.1 TRX_reduct 5..315 CDD:273540 71/304 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.