DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and PLPPR4

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_055654.3 Gene:PLPPR4 / 9890 HGNCID:23496 Length:715 Species:Homo sapiens


Alignment Length:341 Identity:90/341 - (26%)
Similarity:139/341 - (40%) Gaps:71/341 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PIRLLVDLVLLGLLIV------LVENFRRLWGPPTKRGFFCDDESLMYPYHENT---VSPTLLHW 65
            |....|:|.:|...:|      |.:.|:     |...||.|.|.||..||.|.|   :...:|..
Human    20 PCFYFVELPILASSVVSLYFLELTDVFK-----PVHSGFSCYDRSLSMPYIEPTQEAIPFLMLLS 79

  Fly    66 LGLYLPLISLVVLESF----LSHRKDMAPWPTLWPVYN------------TVRW---FLYGYVSN 111
            |....|.|:::|.|..    ||.|::..   .|.|..|            .||:   .::|..|.
Human    80 LAFAGPAITIMVGEGILYCCLSKRRNGV---GLEPNINAGGCNFNSFLRRAVRFVGVHVFGLCST 141

  Fly   112 DLLKGIGKQALGRLRPHFFAVCSPHFPD-GSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDV 175
            .|:..|.:.:.|...|:|..||.|::.. ..||.:.|      |..:..|    |.:...:|...
Human   142 ALITDIIQLSTGYQAPYFLTVCKPNYTSLNVSCKENS------YIVEDIC----SGSDLTVINSG 196

  Fly   176 NVSFPSGHSAMAFYGLVFVALHLRRRRWPLRGS--LLSPVLQLACVALAWFVAISRVIDYKHHWS 238
            ..||||.|:.:|.:..|:|:::...   .|..|  ||.|:|....:.......::|:..||:|..
Human   197 RKSFPSQHATLAAFAAVYVSMYFNS---TLTDSSKLLKPLLVFTFIICGIICGLTRITQYKNHPV 258

  Fly   239 DVAAGSLLGAGSAL-----AVTRAAASEELQWRCQDS-------------LASAKQEAAVVDVAD 285
            ||..|.|:|.|.||     ||.....|:|..::.:|:             |.|||..::...:|.
Human   259 DVYCGFLIGGGIALYLGLYAVGNFLPSDESMFQHRDALRSLTDLNQDPNRLLSAKNGSSSDGIAH 323

  Fly   286 VKGGQQMPH-DLSLVT 300
            .:|.....| |.|.:|
Human   324 TEGILNRNHRDASSLT 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 48/181 (27%)
PLPPR4NP_055654.3 PAP2_wunen 126..275 CDD:239479 45/161 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144647
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.