DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and PLPP2

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_808211.1 Gene:PLPP2 / 8612 HGNCID:9230 Length:309 Species:Homo sapiens


Alignment Length:265 Identity:89/265 - (33%)
Similarity:127/265 - (47%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PTKRGFFCDDESLMYPYHENTVSPTLLHWLGLYLPLISLVVLESFLSH------RKDMAPWPTLW 95
            |.||||:|.|:|:.|||..:|::..|:..:.:...:|.:...|::|.:      |.|...:  :.
Human    52 PYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSDFNNY--VA 114

  Fly    96 PVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESHRGALKY-HTDYE 159
            .||..:..||:|...:..|..:.|..:|||||:|.|||.|         |.|......| ..:..
Human   115 AVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDP---------DWSRVNCSVYVQLEKV 170

  Fly   160 CRPNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRRR---RWPLRGSLLSPVLQLACVAL 221
            ||.|.:..||     ..:||.||||:...|.:||:||:::.|   :|   ..||.|.:|...||.
Human   171 CRGNPADVTE-----ARLSFYSGHSSFGMYCMVFLALYVQARLCWKW---ARLLRPTVQFFLVAF 227

  Fly   222 AWFVAISRVIDYKHHWSDVAAGSLLGA-GSALAV------------TRAAASEELQWRCQDSLAS 273
            |.:|..:||.|||||||||..|.|.|| .:||.|            ......|||:.:...||..
Human   228 ALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTL 292

  Fly   274 AKQEA 278
            ...||
Human   293 TLGEA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 64/175 (37%)
PLPP2NP_808211.1 PAP2_wunen 115..261 CDD:239479 63/162 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144683
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D434801at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.