DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and LCB3

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_012401.1 Gene:LCB3 / 853307 SGDID:S000003670 Length:409 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:46/204 - (22%)
Similarity:71/204 - (34%) Gaps:53/204 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NTVSPTLLHWL--------GLYLPLISLVVLESFLSHRKDMAPWPTLWPVYNTVRWFLY--GYVS 110
            |..|.||..|.        .||....||:...:|...   ..|.|..:..:.|.:..:|  ||  
Yeast    60 NNQSFTLSRWQKKYRSAFNDLYFTYTSLMGSHTFYVL---CLPMPVWFGYFETTKDMVYILGY-- 119

  Fly   111 NDLLKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDV 175
            :..|.|..|.        ::.:..|..|       ..||..|..:|..|                
Yeast   120 SIYLSGFFKD--------YWCLPRPRAP-------PLHRITLSEYTTKE---------------- 153

  Fly   176 NVSFPSGHSAMAFYGLVFVALHLRRRRWPLRGSLLSPVLQLACVALAWFVAI--SRVIDYKHHWS 238
             ...||.|:|.|    ..|:|......|.::.|.:...|.|:||.|.:::.:  .|:....|...
Yeast   154 -YGAPSSHTANA----TGVSLLFLYNIWRMQESSVMVQLLLSCVVLFYYMTLVFGRIYCGMHGIL 213

  Fly   239 DVAAGSLLG 247
            |:.:|.|:|
Yeast   214 DLVSGGLIG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 34/156 (22%)
LCB3NP_012401.1 PAP2_SPPase1 77..230 CDD:239482 41/187 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.