DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and CAX4

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_011550.3 Gene:CAX4 / 852924 SGDID:S000003268 Length:239 Species:Saccharomyces cerevisiae


Alignment Length:216 Identity:44/216 - (20%)
Similarity:71/216 - (32%) Gaps:73/216 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DDESLMYPYHENTVSPTLLHWLGLYLPLISLVVLESFLSHRKDMAPWPTLWPVYNTVRWFL---- 105
            ||..::|..|:      .|.:|..|..|:.::||..:||                   ||:    
Yeast    18 DDTYILYDSHD------FLSFLSAYFSLMPILVLAFYLS-------------------WFIITRE 57

  Fly   106 -------YGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESHRGALKYHTDYECRPN 163
                   :|.:.|::...:.|..:.:.||..|         |:|..:::.|.             
Yeast    58 LEACIVAFGQLMNEIFNNVIKNIIKQPRPVSF---------GASFQNDTIRS------------- 100

  Fly   164 LSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLR-RRRWPLRGSLLSPVLQLACVALAWFVAI 227
                        ....||.||  .|.|..|....|: ...|.....|...:...|...|::.|..
Yeast   101 ------------GYGMPSAHS--QFMGFCFTYNSLKIYTSWKNLNFLEKCIFSGALALLSFCVCF 151

  Fly   228 SRVIDYKHHWSDVAAGSLLGA 248
            |||..:.|:...|..|..:||
Yeast   152 SRVYLHYHNLDQVIVGFSVGA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 32/165 (19%)
CAX4NP_011550.3 PAP2_dolichyldiphosphatase 17..179 CDD:239477 44/216 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.