DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and LPP1

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_010791.3 Gene:LPP1 / 852114 SGDID:S000002911 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:67/254 - (26%)
Similarity:92/254 - (36%) Gaps:103/254 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FFCDDESLMYPYHEN-TVSPTLLHWLGLYLPLISLVVLESFLSHRKDMAPWPTLWPVYNTVRWFL 105
            |..||.|:...|..| .|.|  |..|.|.:.|.::||.            |..::          
Yeast    47 FSLDDPSISKRYVPNELVGP--LECLILSVGLSNMVVF------------WTCMF---------- 87

  Fly   106 YGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDGSS-----------CL------DESHRGALK 153
                ..||||   |..:.|||..         |||.|           ||      :.:..||||
Yeast    88 ----DKDLLK---KNRVKRLRER---------PDGISNDFHFMHTSILCLMLIISINAALTGALK 136

  Fly   154 -----YHTDY--ECRPNLSQATE--------EMIRDVN--------VSFPSGHSA-----MAFYG 190
                 ...|:  .|.|:|.:.::        ::.:..|        .|.|||||:     |.|..
Yeast   137 LIIGNLRPDFVDRCIPDLQKMSDSDSLVFGLDICKQTNKWILYEGLKSTPSGHSSFIVSTMGFTY 201

  Fly   191 L---VFVALHLRRRRWPLRGSLLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLL 246
            |   ||...:.|...|              |..||..|.:|||||::|||.||.:|::|
Yeast   202 LWQRVFTTRNTRSCIW--------------CPLLALVVMVSRVIDHRHHWYDVVSGAVL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 52/199 (26%)
LPP1NP_010791.3 PAP2_containing_1_like 52..258 CDD:239484 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2766
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
TreeFam 1 0.960 - -
65.910

Return to query results.
Submit another query.