DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and PLPP5

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_024303075.1 Gene:PLPP5 / 84513 HGNCID:25026 Length:342 Species:Homo sapiens


Alignment Length:275 Identity:79/275 - (28%)
Similarity:112/275 - (40%) Gaps:83/275 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VDLVLLGLLIV--LVENFRRLWGP----------------PTKRGFFCDDESLMYPYHENTVSPT 61
            |.|.|....:|  |:..|:||..|                |||..|...:.|...|.|:......
Human    65 VRLALFAAFLVTELLPPFQRLIQPEEMWLYRNPYVEAEYFPTKPMFVRGERSSFLPPHDPASRGH 129

  Fly    62 L--LH----WLGLYLPLISLVVLESFL-------SHRKDMAPWPTLWPVYNTVRWFLYGYVSNDL 113
            |  .|    ::..:|..:||:.|..||       |.:..:|.         ::...|.|..:|.:
Human   130 LCVFHPETAFVIAFLSPLSLIFLAKFLKKADTRDSRQACLAA---------SLALALNGVFTNTI 185

  Fly   114 LKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVS 178
                 |..:||.||.||..|   ||||.:            |:|..|     ...::::.:...|
Human   186 -----KLIVGRPRPDFFYRC---FPDGLA------------HSDLMC-----TGDKDVVNEGRKS 225

  Fly   179 FPSGHSAMAFYGLVFVALHL-----------RRRRWPLRGSLLSPVLQLACVALAWFVAISRVID 232
            ||||||:.||.||.|.:.:|           |.:.|.. .:.|||:|..|.:||      ||..|
Human   226 FPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWRF-CAFLSPLLFAAVIAL------SRTCD 283

  Fly   233 YKHHWSDVAAGSLLG 247
            |||||.||..||::|
Human   284 YKHHWQDVLVGSMIG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 53/163 (33%)
PLPP5XP_024303075.1 PAP2_containing_1_like 92..309 CDD:239484 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144690
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.