DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and LPP4

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_566602.1 Gene:LPP4 / 821350 AraportID:AT3G18220 Length:308 Species:Arabidopsis thaliana


Alignment Length:240 Identity:71/240 - (29%)
Similarity:122/240 - (50%) Gaps:44/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVLLGLL-IVL--VENFRRLWGPPTKRGFFCDDESLMYPYHENTVSPTLLHWLGLYLPLISLVVL 78
            ||:|||: |||  :|.|.|..||...       ..|.:|::|:|:....:..:.:.:|:...:| 
plant    29 LVVLGLIDIVLNVIEPFHRYIGPDML-------TDLTFPFYEDTIPMWAVPIICILVPICIFIV- 85

  Fly    79 ESFLSHRKDMAPWPTLWPVYNTVRWFLYGYVSNDLLKGIG----KQALGRLRPHFFAVCSPHFPD 139
              :..:|:|         ||: :...:.|...:.|:.|:.    |.|:||.||:||..|   ||:
plant    86 --YYYYRRD---------VYD-LHHAILGIGFSCLVTGVTTDSIKDAVGRPRPNFFYRC---FPN 135

  Fly   140 GSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHL--RRRR 202
            |..          |:|.|  .:..:....:::|::...||||||::.:|.||.|:|.:|  :.:.
plant   136 GKP----------KFHPD--TKDVVCHGVKKIIKEGYKSFPSGHTSWSFAGLTFLAWYLSGKIKV 188

  Fly   203 WPLRGSLLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLG 247
            :..||.:....|....:.::..:.||||.||.|||:||.||:::|
plant   189 FDRRGHVAKLCLVFLPILISILIGISRVDDYWHHWTDVFAGAIIG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 50/158 (32%)
LPP4NP_566602.1 PgpB 23..246 CDD:223743 71/240 (30%)
PAP2_containing_1_like 55..244 CDD:239484 58/207 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.