DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and LPP3

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_566177.1 Gene:LPP3 / 821299 AraportID:AT3G02600 Length:364 Species:Arabidopsis thaliana


Alignment Length:248 Identity:83/248 - (33%)
Similarity:120/248 - (48%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLVDLVLLGLLIVLVENFRRLWGPPTKRGFFCDDESLMYPYHENTVSPTLLHW-LGLYLPLISLV 76
            :||.||:|..:::::..|.|..|    :....|   |.||...||| |.   | :.:|..|:.||
plant    78 ILVLLVILECVLLIIHPFYRFVG----KDMMTD---LSYPLKSNTV-PI---WSVPVYAMLLPLV 131

  Fly    77 VLESFLSHRKDMAPWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDGS 141
            :.......|:|      ::.:::.|...||..:...:|....|.|:||.||.||..|   ||||.
plant   132 IFIFIYFRRRD------VYDLHHAVLGLLYSVLVTAVLTDAIKNAVGRPRPDFFWRC---FPDGK 187

  Fly   142 SCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRRRRWPLR 206
            :..|.  .|.:..|.|           :.:||:.:.||||||::.:|.||.|::|:|..:.....
plant   188 ALYDS--LGDVICHGD-----------KSVIREGHKSFPSGHTSWSFSGLGFLSLYLSGKIQAFD 239

  Fly   207 GSLLSPVLQLACVAL----AWFVAISRVIDYKHHWSDVAAGSLLGAGSALAVT 255
            |.  ..|.:|..|.|    |..|.||||.||.|||.||.||.|||    ||::
plant   240 GK--GHVAKLCIVILPLLFAALVGISRVDDYWHHWQDVFAGGLLG----LAIS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 60/162 (37%)
LPP3NP_566177.1 PLN02731 1..364 CDD:178332 83/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.