DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and Sgpp1

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_109675.1 Gene:Sgpp1 / 81535 MGIID:2135760 Length:430 Species:Mus musculus


Alignment Length:103 Identity:29/103 - (28%)
Similarity:38/103 - (36%) Gaps:31/103 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LSQATEEMIR----------------DVNVSFPSGHSAMAFYGLVFVALHLRRRRW--PL-RGSL 209
            |.|.|:::||                :...|.||.| ||:...:......|...||  || .|.:
Mouse   162 LGQCTKDIIRWPRPASPPVIKLEVFYNSEYSMPSTH-AMSGTAIPIAMFLLTYGRWQYPLIYGLI 225

  Fly   210 LSPVLQLACVALAW--FVAISRVIDYKHHWSDVAAGSL 245
            |.|         .|  .|.:||:....|...||.||.|
Mouse   226 LIP---------CWSSLVCLSRIYMGMHSILDVIAGFL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 29/103 (28%)
Sgpp1NP_109675.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..103
PgpB <117..273 CDD:223743 29/103 (28%)
PAP2_SPPase1 117..264 CDD:239482 29/103 (28%)
Phosphatase sequence motif I. /evidence=ECO:0000305 167..175 2/7 (29%)
Phosphatase sequence motif II. /evidence=ECO:0000305 194..197 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000305 237..248 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.