DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and PLPPR3

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_079164.1 Gene:PLPPR3 / 79948 HGNCID:23497 Length:746 Species:Homo sapiens


Alignment Length:309 Identity:73/309 - (23%)
Similarity:112/309 - (36%) Gaps:92/309 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PIRLLVDLVLLGLLIV------LVENFRRLWGPPTKRGFFCDDESLMYPY---HENTVSPTLLHW 65
            |....|:|.::...||      |.:.|:     |.|.||.|.|.:|..||   :|..:...:|..
Human    19 PCFYFVELPIVASSIVSLYFLELTDLFK-----PAKVGFQCYDRTLSMPYVETNEELIPLLMLLS 78

  Fly    66 LGLYLPLISLVVLESFLSHRKDMAPWPTLWP----------------------VYNTVRW---FL 105
            |....|..|::|.|..|...:.     .||.                      :..|||:   .:
Human    79 LAFAAPAASIMVAEGMLYCLQS-----RLWGRAGGPAGAEGSINAGGCNFNSFLRRTVRFVGVHV 138

  Fly   106 YGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFP-DGSSCLDESHRGALKYHTDYECRPNLSQ--- 166
            :|..:..|:..:.:.|.|...|.|..||.|::. .|:||               |..|.::|   
Human   139 FGLCATALVTDVIQLATGYHTPFFLTVCKPNYTLLGTSC---------------EVNPYITQDIC 188

  Fly   167 --ATEEMIRDVNVSFPSGHSAMAFYGLVFV-----------ALHLRRRRWPLRGS---------- 208
              .....|.....:|||.|:.::.:..|:|           ||.|.|....|..:          
Human   189 SGHDIHAILSARKTFPSQHATLSAFAAVYVSVSPAPHCPSQALLLTRGEPSLTPTPMPQMYFNSV 253

  Fly   209 ------LLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSA 251
                  ||.|:|..|....|....::::..|:.|..||.||.|:|||.|
Human   254 ISDTTKLLKPILVFAFAIAAGVCGLTQITQYRSHPVDVYAGFLIGAGIA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 47/214 (22%)
PLPPR3NP_079164.1 PAP2_wunen 129..306 CDD:239479 47/189 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144676
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.