DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and Plpp5

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_082276.1 Gene:Plpp5 / 71910 MGIID:1919160 Length:260 Species:Mus musculus


Alignment Length:250 Identity:80/250 - (32%)
Similarity:113/250 - (45%) Gaps:58/250 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IRLLVDLVLLGLLIVLVENFRRLWGPPTKRGFFCDDESLMY--PYHENTVSPTLLHWLGLYLPLI 73
            :|:|  |.:..|:..|:..|:|...|         :|..:|  ||.|....||...::..:|..:
Mouse    12 VRVL--LFVAFLVTELLPPFQRRIQP---------EELWLYRNPYVEAEYFPTGRMFVIAFLTPL 65

  Fly    74 SLVVLESFLSHRKDMAPWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFP 138
            ||:.|..||  ||..|.......:..::...|.|..:|     |.|..:||.||.||..|   ||
Mouse    66 SLIFLAKFL--RKADATDSKQACLAASLALALNGVFTN-----IIKLIVGRPRPDFFYRC---FP 120

  Fly   139 DGSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHL----- 198
            ||.:            |:|..|     ...|:::.:...|||||||:.||.||.|.:.:|     
Mouse   121 DGLA------------HSDLTC-----TGDEDVVNEGRKSFPSGHSSFAFAGLAFASFYLAGKLH 168

  Fly   199 ------RRRRWPLRGSLLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLG 247
                  |.:.|.| .:.|||:|..|.:||      ||..||||||.||..||::|
Mouse   169 CFTPQGRGKSWRL-CAFLSPLLFAAVIAL------SRTCDYKHHWQDVLVGSMIG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 55/162 (34%)
Plpp5NP_082276.1 PAP2_containing_1_like 39..227 CDD:239484 70/211 (33%)
Phosphatase sequence motif I. /evidence=ECO:0000250|UniProtKB:Q8NEB5 104..112 3/7 (43%)
Phosphatase sequence motif II. /evidence=ECO:0000250|UniProtKB:Q8NEB5 145..148 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000250|UniProtKB:Q8NEB5 197..207 7/9 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834802
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.