DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and Dolpp1

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_065062.1 Gene:Dolpp1 / 57170 MGIID:1914093 Length:238 Species:Mus musculus


Alignment Length:217 Identity:50/217 - (23%)
Similarity:78/217 - (35%) Gaps:59/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YHENTVSPTLLHWLGLYLPLISLVVLESFLSHRKDMAPWPTLWPVYNTVRWFLYGYVSNDLLKGI 117
            |....:|..||.:|.| .|:..:|...:.:..::::          :|:. ||.|...|..:..:
Mouse    23 YPAGDLSGHLLAYLSL-SPIFVVVGFLTLIIFKREL----------HTIS-FLGGLALNQGVNWL 75

  Fly   118 GKQALGRLRPHFFAVC-SPHFPDGSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPS 181
            .|..:...||     | .||...|:           ||                       ..||
Mouse    76 IKHVIQEPRP-----CGGPHTAVGT-----------KY-----------------------GMPS 101

  Fly   182 GHSAMAFYGLVFVALHLRRRRWPLRGS-----LLSPVLQLACVALAWFVAISRVIDYKHHWSDVA 241
            .||...::..|:..|.|..|......:     |...||.|..:..|:.|:.|||....|.||.|.
Mouse   102 SHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVF 166

  Fly   242 AGSLLGAGSALAVTRAAASEEL 263
            .|.:  |||.:||.....::|:
Mouse   167 YGGV--AGSLMAVAWFIITQEI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 40/164 (24%)
Dolpp1NP_065062.1 PgpB 9..184 CDD:223743 49/213 (23%)
PAP2_dolichyldiphosphatase 16..180 CDD:239477 49/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.