DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and plpp1a

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_697507.5 Gene:plpp1a / 569053 ZFINID:ZDB-GENE-080225-26 Length:282 Species:Danio rerio


Alignment Length:258 Identity:92/258 - (35%)
Similarity:138/258 - (53%) Gaps:34/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPIRLLVDLVLLGLLIVLVENFRRLWGPPTKRGFFCDDESLMYPYHENTVSPTLLHWLGLYLPLI 73
            |.|.|.:..::|..|.:...|..::  .|.:|||||:|||:.||:|.:||:.|:|:.:|..||:.
Zfish     8 PFILLDIACLILADLPLAAFNLGKI--KPYQRGFFCNDESIRYPFHSSTVTSTVLYTVGFTLPIC 70

  Fly    74 SLVV---LESFLSHRKD-------MAPWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPH 128
            |:::   |..:|:..|.       :|      .||..:..|::|...:..|..|.|.::||||||
Zfish    71 SMIIGECLSVYLNRIKSNSFCNGYVA------CVYKAIGTFVFGAAISQSLTDIAKYSIGRLRPH 129

  Fly   129 FFAVCSPHFPDGS--SCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYGL 191
            |..||.   ||.|  :|.    .||  |..|:.|     ...|.::.:..:||.||||:.:.|.:
Zfish   130 FLDVCK---PDWSKINCT----AGA--YIEDFVC-----TGKESVVNEGRLSFYSGHSSFSMYCM 180

  Fly   192 VFVALHLRRRRWPLRGSLLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSALAV 254
            :|:||:|:.|.......||.|.||...:|.:.:..:|||.|||||||||..|.:.||..||.|
Zfish   181 LFLALYLQARMQAEWARLLRPTLQFFLIAASVYTGLSRVSDYKHHWSDVLTGLIQGAIVALLV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 62/161 (39%)
plpp1aXP_697507.5 PAP2_wunen 98..244 CDD:239479 62/160 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577779
Domainoid 1 1.000 47 1.000 Domainoid score I11977
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.