DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and ppap2d

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001073447.1 Gene:ppap2d / 559124 ZFINID:ZDB-GENE-061201-42 Length:323 Species:Danio rerio


Alignment Length:261 Identity:77/261 - (29%)
Similarity:131/261 - (50%) Gaps:46/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RLLVDLVLLGLLIVLVENF----RRLWGPPTKRGFFCDDESLMYPYHENTVSP-TLLHWLGLYLP 71
            ::||.|.:|.||:..:..|    :.:  .|..|||||.|.|:.|||.|:...| ::|...|:.:.
Zfish    52 KMLVGLDILCLLVASIPFFACELKAV--TPYMRGFFCGDTSITYPYIESEAIPDSVLIAGGIIIT 114

  Fly    72 LISLVVLESFLSHRKDM---APWPTLWP--VYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFA 131
            .:::.|.|.:....:|:   |....|:.  :|..:..||:|......|..:.|.::|||||||.:
Zfish   115 GLTIAVGECYRVRFRDVHSRAFVRNLYVSCLYKELGSFLFGCCVGQSLTNMAKLSVGRLRPHFLS 179

  Fly   132 VCSPHFPDGSSCLDESHRGALKYHTDYE---CRPN------LSQATEEMIRDVNVSFPSGHSAMA 187
            .|                     :..||   |.|.      :.:::::::.:...||.|||::.|
Zfish   180 AC---------------------NVTYESLNCTPGTYISHVVCKSSKKIVEEARKSFFSGHASFA 223

  Fly   188 FYGLVFVALHLRRR-RWPLRGS-LLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGS 250
            .|.::::|.:|:.| .|  :|: ||.|:||...|.||.:..:||:.||:||.:||..|.|.|..:
Zfish   224 MYTMLYLAFYLQARLSW--QGARLLRPLLQFMLVMLAVYTGLSRISDYRHHPTDVLTGFLQGGLT 286

  Fly   251 A 251
            |
Zfish   287 A 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 50/169 (30%)
ppap2dNP_001073447.1 PAP2_wunen 145..291 CDD:239479 50/166 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577811
Domainoid 1 1.000 47 1.000 Domainoid score I11977
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.