DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and plpp3

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_001919561.1 Gene:plpp3 / 557680 ZFINID:ZDB-GENE-060526-241 Length:312 Species:Danio rerio


Alignment Length:240 Identity:79/240 - (32%)
Similarity:131/240 - (54%) Gaps:28/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVLLGLLIVLVENFRRLWGPPTKRGFFCDDESLMYPY-HENTVSPTLLHWLGLYLPLISLVVLES 80
            |.:|..||:.....:     |..|||:|.|:|:.||| :.:|:|..:|...|:.:.:.|:|:.|.
Zfish    45 LAVLPFLIIETSTIK-----PYHRGFYCSDQSIQYPYKNGDTISDAVLCAAGILIVIFSIVIGEC 104

  Fly    81 FLSH-----RKDMAPWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDG 140
            :..|     .|.....|.:..:|..|..|::|...:.....|.|.::||:||||..||.|::   
Zfish   105 YRIHYLSQGSKSFVGNPYVSALYRQVGVFIFGCAVSQSFTDIAKVSVGRMRPHFLDVCRPNY--- 166

  Fly   141 SSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRRR-RWP 204
             |.:|.|    |.|.|:|.|..:.|:     :::...||.|||::.:.|.::::|.:|:.| .| 
Zfish   167 -STIDCS----LGYITEYTCTGDPSK-----VQEARKSFFSGHASFSMYTMLYLAFYLQSRFTW- 220

  Fly   205 LRGS-LLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGA 248
             ||: ||.|:||...:.:|::..:|||.|:|||.:||.||.:.||
Zfish   221 -RGARLLRPLLQFTLLMMAFYTGLSRVSDHKHHPTDVLAGFVQGA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 55/155 (35%)
plpp3XP_001919561.1 PAP2_wunen 125..271 CDD:239479 55/155 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577771
Domainoid 1 1.000 47 1.000 Domainoid score I11977
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D434801at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.