DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and sgpp1a

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_684347.1 Gene:sgpp1a / 556439 ZFINID:ZDB-GENE-030131-4695 Length:436 Species:Danio rerio


Alignment Length:100 Identity:27/100 - (27%)
Similarity:38/100 - (38%) Gaps:25/100 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LSQATEEMIR----------------DVNVSFPSGHSAMAFYGLVFVALHLRRRRWPLRGSLLSP 212
            |.|:|::::|                :...|.||.| ||:...|.|....|...||..      |
Zfish   168 LGQSTKDVVRWTRPASPPVVKVEVFYNSEYSMPSTH-AMSGTALPFSLFLLTCSRWEY------P 225

  Fly   213 VLQLACVALAW--FVAISRVIDYKHHWSDVAAGSL 245
            .:....:||.|  .|.|||:....|...:|..|.|
Zfish   226 FMFGLSIALFWSILVCISRIYMGMHSVLEVITGFL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 26/99 (26%)
sgpp1aXP_684347.1 PAP2_SPPase1 121..270 CDD:239482 26/99 (26%)
PgpB <122..281 CDD:223743 26/99 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.