DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and plpp3

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001016858.3 Gene:plpp3 / 549612 XenbaseID:XB-GENE-941073 Length:307 Species:Xenopus tropicalis


Alignment Length:242 Identity:85/242 - (35%)
Similarity:133/242 - (54%) Gaps:30/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVLLGLLIVLVENFRRLWGPPTKRGFFCDDESLMYPYHE-NTVSPTLLHWLGLYLPLISLVVLES 80
            |::.||..:::|....   .|.:|||:|||||:.||.:. .|:|..:|..:|:.:.:::::|.|.
 Frog    44 LIVAGLPFLIIETSTI---QPYRRGFYCDDESIKYPANSGETISDAVLSAVGILIAILAIIVGEF 105

  Fly    81 FLSHRKDMAPW-----PTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDG 140
            |..|.....|.     |.:..:|..|..|.:|...:.....|.|.|:|||||||..||:|.|   
 Frog   106 FRIHYLKERPHSFIQNPYVAALYKQVGCFAFGCAVSQSFTDIAKVAIGRLRPHFINVCNPDF--- 167

  Fly   141 SSCLDESHRGALKYHTDYECR--PNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRRR-R 202
             |.:|.|    |.|..:|:||  ||       .:.:...||.|||::.:.|.::::.|:|:.| .
 Frog   168 -STIDCS----LGYIENYQCRGPPN-------KVMEARKSFFSGHASFSMYTMLYLVLYLQSRFT 220

  Fly   203 WPLRGS-LLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGA 248
            |  ||: ||.|:||...:.:|::..:|||.|:|||.|||.||.:.||
 Frog   221 W--RGARLLRPLLQFTLLMMAFYTGLSRVSDHKHHPSDVLAGFVQGA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 60/157 (38%)
plpp3NP_001016858.3 PAP2_wunen 126..272 CDD:239479 60/157 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D434801at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.120

Return to query results.
Submit another query.