DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and CG11426

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_649394.1 Gene:CG11426 / 40471 FlyBaseID:FBgn0037166 Length:340 Species:Drosophila melanogaster


Alignment Length:258 Identity:107/258 - (41%)
Similarity:154/258 - (59%) Gaps:29/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RLLVDLVLLGLLI--VLVENFRRLWGPPTKRGFFCDDESLMYPYHENTVSPTLLHWLGLYLPLIS 74
            ||||:|:::.:|:  :.|..|.   ..|.:|||||||||:.||:.:||::|.:|..:...||.:.
  Fly    37 RLLVELLVVVVLVIPICVYEFA---VDPVRRGFFCDDESISYPFQDNTITPVMLGLIVGLLPALV 98

  Fly    75 LVVLESFLSHRK--------DMAPW-PTLWPVY--NTVRWFLYGYVSNDLLKGIGKQALGRLRPH 128
            :||:| ::||.:        |:..| .:.|.|.  ....:|.:|.:.......:||..:||||||
  Fly    99 MVVVE-YVSHLRAGDISATVDLLGWRVSTWYVELGRQSTYFCFGLLLTFDATEVGKYTIGRLRPH 162

  Fly   129 FFAVCSPHFPDGSSCLD--ESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYGL 191
            |.|||.|...|||.|.|  ..||    |..:|:|..  ...|.|.:|...:|||||||::|||.:
  Fly   163 FLAVCQPQIADGSMCSDPVNLHR----YMENYDCAG--EGFTVEDVRQARLSFPSGHSSLAFYAM 221

  Fly   192 VFVALHLRRR-RWPLRGSLLS-PVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSAL 252
            ::|||:|:|: .|  |||.|| ..:|.|.|.:||:.|:|||:|:.||||||.:|||||...||
  Fly   222 IYVALYLQRKITW--RGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLSGSLLGVAGAL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 73/163 (45%)
CG11426NP_649394.1 PAP2_wunen 130..285 CDD:239479 72/161 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468189
Domainoid 1 1.000 47 1.000 Domainoid score I11977
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46697
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.