DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and CG11437

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_649393.1 Gene:CG11437 / 40470 FlyBaseID:FBgn0037165 Length:305 Species:Drosophila melanogaster


Alignment Length:278 Identity:82/278 - (29%)
Similarity:129/278 - (46%) Gaps:33/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFNLSLRPPIRLLVD-LVLLGL----LIVLVENFRRLWGPPTKRGFFCDDESLMYPYHENTVSP 60
            |..|.:.|...||::| |:|||:    |:||.:..     ...:|||.|.|.||.|||.:..::.
  Fly     1 MCGNPNTRLLSRLVIDFLILLGIYGAALVVLPQQL-----STAQRGFHCSDTSLKYPYRQPWLTK 60

  Fly    61 TLLHWLGLYLPLISLVVLESFLSHRKDMAPWPT----------------LWPVYNTVRWFLYGYV 109
            ..|....:.||...::|:|..   |..:.|..|                :...|..:..:|:|..
  Fly    61 VHLTIAVVALPAAFVLVVEML---RAAVVPSSTELTQRFVFVGVRIPRFISECYKAIGVYLFGLG 122

  Fly   110 SNDLLKGIGKQALGRLRPHFFAVCSPHF--PDGSSCLDESHRGALKYHTDYECRPNLSQATEEMI 172
            .......:.|.:.|||||:||.:|.|.:  ..|.||.|.:.:.:..|..|:.|..  ..|:::::
  Fly   123 LTLAAIRLTKHSTGRLRPYFFDICQPTWGTEGGESCSDVTAQNSTLYLEDFSCTE--FAASQDLL 185

  Fly   173 RDVNVSFPSGHSAMAFYGLVFVALHLRRRRWPLRGSLLSPVLQLACVALAWFVAISRVIDYKHHW 237
            ..|..|||||..:...|.:.|:..:.:.|.:.....|:...|||||.:||..|...|:..|::|.
  Fly   186 ALVRHSFPSGFVSTTCYAMGFLIFYSQARLFAPWLRLVRASLQLACCSLALVVCWERISTYQNHL 250

  Fly   238 SDVAAGSLLGAGSALAVT 255
            :|||||:.||...|...|
  Fly   251 TDVAAGAALGGWMAFFAT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 50/160 (31%)
CG11437NP_649393.1 PAP2_wunen 109..268 CDD:239479 50/160 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468201
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46697
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
76.990

Return to query results.
Submit another query.