DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and laza

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster


Alignment Length:223 Identity:89/223 - (39%)
Similarity:126/223 - (56%) Gaps:13/223 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KRGFFCDDESLMYPYHENTVSPTLLHWLGLYLPLISLVVLE--SFLSHRKDMAPWPTLWPVYNTV 101
            ||||||.|.|:.|||.:.|::..:|..:.|.||::.:.|:|  ......:....:..||....| 
  Fly     5 KRGFFCSDLSIRYPYKDCTITVPMLLLMMLLLPMLFVAVVEIMRICKRFRTRLYFRNLWRAEAT- 68

  Fly   102 RWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESHRGALKYHTDYECRPNLSQ 166
              |.:|:::..|...:.|.|:||||||||..|.|...|||||.|  .:.|..|...:.|..|  .
  Fly    69 --FSFGFIATYLTTELAKHAVGRLRPHFFHGCQPRLDDGSSCSD--LQNAELYVEQFHCTNN--N 127

  Fly   167 ATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRRRRWPLRGS--LLSPVLQLACVALAWFVAISR 229
            .:...||:::|||||.||:::||.:|.:||:: ...|..||.  :|..|||...:..|..|::||
  Fly   128 LSTRQIRELHVSFPSAHSSLSFYSMVLLALYV-HGVWRGRGGVRVLRHVLQFLLLMAALCVSLSR 191

  Fly   230 VIDYKHHWSDVAAGSLLGAGSALAVTRA 257
            |.||.||||||.||:|||...| |:|.|
  Fly   192 VADYWHHWSDVLAGALLGVTYA-AITAA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 67/160 (42%)
lazaNP_649391.1 PAP2_wunen 62..217 CDD:239479 69/163 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468190
Domainoid 1 1.000 122 1.000 Domainoid score I3483
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434801at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46697
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
87.990

Return to query results.
Submit another query.