DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and Plpp4

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001074432.1 Gene:Plpp4 / 381925 MGIID:2685936 Length:271 Species:Mus musculus


Alignment Length:265 Identity:67/265 - (25%)
Similarity:106/265 - (40%) Gaps:84/265 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IRLLVDLVLLGLLIV--LVENFRRLWGPPTKRGFFCDDESLMY--PYHENTVSPT-LLHWLGLYL 70
            |.:.|..:|.|:.:.  .::.|:|:..|         :|..:|  |..::...|| |:..:....
Mouse     6 IEIGVRALLFGVFVFTEFLDPFQRVIQP---------EEIWLYKNPLVQSDNIPTRLMFAISFLT 61

  Fly    71 PLISLVVL------------ESFLSHRKDMAPWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALG 123
            ||..:.|:            |:||:....:|               |.|..:|.:     |..:|
Mouse    62 PLAVICVVKIIRRTDKTEIKEAFLAVSLALA---------------LNGVCTNTI-----KLIVG 106

  Fly   124 RLRPHFFAVCSPHFPDGSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAF 188
            |.||.||..|   ||||            ..:::..|     ....:::.:...||||.||:.||
Mouse   107 RPRPDFFYRC---FPDG------------VMNSEMRC-----TGDPDLVSEGRKSFPSIHSSFAF 151

  Fly   189 YGLVFVALHL-----------RRRRWPLRGSLLSPVLQLACVALAWFVAISRVIDYKHHWSDVAA 242
            .||.|...:|           |.:.|    .|.:.:|.|.|   |..:|:||:.||||||.|...
Mouse   152 SGLGFTTFYLAGKLHCFTESGRGKSW----RLCAAILPLYC---AMMIALSRMCDYKHHWQDSFV 209

  Fly   243 GSLLG 247
            |.::|
Mouse   210 GGVIG 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 47/163 (29%)
Plpp4NP_001074432.1 PAP2_containing_1_like 37..225 CDD:239484 59/225 (26%)
Phosphatase sequence motif I. /evidence=ECO:0000250|UniProtKB:Q5VZY2 102..110 3/7 (43%)
Phosphatase sequence motif II. /evidence=ECO:0000250|UniProtKB:Q5VZY2 143..146 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000250|UniProtKB:Q5VZY2 195..205 7/9 (78%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834781
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.