DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and Plppr5

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_038958360.1 Gene:Plppr5 / 310812 RGDID:1309567 Length:344 Species:Rattus norvegicus


Alignment Length:234 Identity:62/234 - (26%)
Similarity:108/234 - (46%) Gaps:31/234 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RGFFCDDESLMYPY----HENTVSPTLLHWLGLYLPLISLVVLES-----------FLSHRKDMA 89
            :||||.|.:...||    ..:.|.|.||:.|...:|::.::|.|:           |.:..|.:.
  Rat    41 QGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQEKTIL 105

  Fly    90 PWPTLW--P-VYNTVRW---FLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESH 148
            .....:  | |..|||:   :.:|..:.|:....|:...|.|.|||.|:|.|::         :.
  Rat   106 TGDCCYINPLVRRTVRFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNY---------TA 161

  Fly   149 RGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRRRRWPLRGSLLSPV 213
            .|..:| |.:...........::|.....:|||..:|::.|..:::.:::..........|..||
  Rat   162 LGCQQY-TQFISGEEACTGNPDLIMRARKTFPSKEAALSVYAAMYLTMYITNTIKAKGTRLAKPV 225

  Fly   214 LQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSAL 252
            |.|..:.||:...::||.:|::|||||.||.|:|...|:
  Rat   226 LCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 45/161 (28%)
Plppr5XP_038958360.1 PAP2_wunen 118..267 CDD:239479 43/157 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338356
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.