DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and Plppr2

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_006242690.1 Gene:Plppr2 / 300443 RGDID:1597171 Length:452 Species:Rattus norvegicus


Alignment Length:286 Identity:75/286 - (26%)
Similarity:123/286 - (43%) Gaps:68/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PIRLLVDLVLLGLLIVL------VENFRRLWGPPTKRGFFCDDESLMYPY----HENTVSPTLLH 64
            |..:.|:.||||::|:|      .:.|     |...:||||.|.:...||    ..:...|.|::
  Rat    16 PCFVFVESVLLGIVILLAYRLEFTDTF-----PVHTQGFFCYDSAYAKPYPGPEAASRAPPALIY 75

  Fly    65 WLGLYLPLISLVVLESFLSHRKDMAPWPTLWPV------------------YNTVRW---FLYGY 108
            .|....|.:::::.|  |:.....|| |:..||                  ...||:   :.:|.
  Rat    76 ALVTAGPTLTILLGE--LARAFFPAP-PSASPVSGESTIVSGACCRFSPPLRRLVRFLGVYSFGL 137

  Fly   109 VSNDLLKGIGKQALGRLRPHFFAVCSPHF---------PDGSSCLDESHRGALKYHTDYEC---R 161
            .:..:....|:...|...|||.:||.|::         ||        ..|..::.||...   .
  Rat   138 FTTTIFANAGQVVTGNPTPHFLSVCRPNYTALGCPPPSPD--------RPGPDRFVTDQSACAGS 194

  Fly   162 PNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRRRRWPLRGS-LLSPVLQLACVALAWFV 225
            |:|..|...       :||...:|:..|.:.:.|::: ...:.::|| |:.|.|.||.:..|:.|
  Rat   195 PSLVAAARR-------AFPCKDAALCAYAVTYTAMYV-TLVFRVKGSRLVKPSLCLALLCPAFLV 251

  Fly   226 AISRVIDYKHHWSDVAAGSLLGAGSA 251
            .:.||.:|::|||||.||.|.||..|
  Rat   252 GVVRVAEYRNHWSDVLAGFLTGAAIA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 49/190 (26%)
Plppr2XP_006242690.1 PAP2_wunen 125..281 CDD:239479 47/169 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338317
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.