DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and Plppr1

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_958428.2 Gene:Plppr1 / 298062 RGDID:1303116 Length:325 Species:Rattus norvegicus


Alignment Length:290 Identity:71/290 - (24%)
Similarity:126/290 - (43%) Gaps:54/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PIRLLVDLVLLGLLIVLVENFR-------RLWGPPTKRGFFCDDESLMYPY----HENTVSPTLL 63
            |..:.|:||::...::|...|.       .:      :||||.|..||.||    .|:.:||.:|
  Rat    15 PCFIFVELVIMAGTVLLAYYFECTDTFQVHI------QGFFCQDGDLMKPYPGTEEESFISPLVL 73

  Fly    64 HWL-------GLYLPLISLVVL----ESFLSHRKDMAPW------PTLWPVYNTVRWFLYGYVSN 111
            :.:       .:::..||:..:    ||.::..|.:...      |.|..:...:..|.:|..:.
  Rat    74 YCVLAATPTAIIFIGEISMYFIKSTRESLIAEEKMILTGDCCYLSPLLRRIVRFIGVFAFGLFAT 138

  Fly   112 DLLKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVN 176
            |:....|:...|.|.|:|..||.|:: ..:.|         :.|..:....|:.....|:|....
  Rat   139 DIFVNAGQVVTGHLTPYFLTVCQPNY-TSTDC---------RAHHQFINNGNICTGDLEVIEKAR 193

  Fly   177 VSFPSGHSAMAFYGLVFVALHLRRRRWPLRGSLLSPVLQLACVALAWFVAISRVIDYKHHWSDVA 241
            .||||.|:|::.|..::..:::..........|..|||.|..:..|:...::||.:|::|.|||.
  Rat   194 RSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVI 258

  Fly   242 AGSLLGAGSALAV----------TRAAASE 261
            ||.:||...||.:          |:.:||:
  Rat   259 AGFILGTAVALFLGMCVVHNFKGTQGSASK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 42/168 (25%)
Plppr1NP_958428.2 PAP2_wunen 123..272 CDD:239479 42/158 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338349
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.