DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and SPBC409.18

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_595468.1 Gene:SPBC409.18 / 2541078 PomBaseID:SPBC409.18 Length:279 Species:Schizosaccharomyces pombe


Alignment Length:234 Identity:64/234 - (27%)
Similarity:102/234 - (43%) Gaps:47/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PTKRGFFCDDESLMYPY--HENTVSPTLLHWLGLYLPLISLVVLESFLSHRKD-MAPWPTLWPVY 98
            |..|.|..:|.::.:|:  ||..  ||  .:||:.......:||..|...|.: :..|.:|..: 
pombe    37 PFTRQFSLEDITISHPFALHEQV--PT--KYLGIICVFFPALVLYGFGKLRNNSLLFWKSLMGL- 96

  Fly    99 NTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESHRGALKYHTDYECRPN 163
                  ||..:...|...:.|.|:||.||.|.|.|.|                      :|..|.
pombe    97 ------LYSTMVCGLCVSLLKNAVGRPRPDFLARCQP----------------------FESTPK 133

  Fly   164 LSQA---------TEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRRRRWPLRGSLLS--PVLQLA 217
            ....         ::::::|...||||||::.:|.||.|:|:.|..:....|....|  .|:.|.
pombe   134 TGLVDVLSCSVPWSDKVLQDGFRSFPSGHTSFSFAGLGFLAIFLAGQLKMFRNKTSSWKVVVPLV 198

  Fly   218 CVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSALAVTR 256
            .:::|.::.:||..||:||..|:|.|:|.|...|..|.|
pombe   199 PLSIASWIGLSRSQDYRHHKEDIAVGALFGFAIAYVVYR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 45/169 (27%)
SPBC409.18NP_595468.1 PgpB 7..247 CDD:223743 64/234 (27%)
PAP2_containing_1_like 47..238 CDD:239484 60/224 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1868
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.