DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and Plpp3

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_620260.2 Gene:Plpp3 / 192270 RGDID:620454 Length:312 Species:Rattus norvegicus


Alignment Length:240 Identity:74/240 - (30%)
Similarity:128/240 - (53%) Gaps:28/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVLLGLLIVLVENFRRLWGPPTKRGFFCDDESLMYPYH-ENTVSPTLLHWLGLYLPLISLVVLES 80
            :..|..||:.....:     |.:|||:|:|||:.||.. ..|::..:|..:|:.:.:::::..|.
  Rat    46 MAALPFLIIETSTIK-----PYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGEF 105

  Fly    81 F-LSHRKDMA----PWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDG 140
            : :.:.|:.:    ..|.:..:|..|..||:|...:.....|.|.::|||||||.:||.|.|.. 
  Rat   106 YRIYYLKEKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQ- 169

  Fly   141 SSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRRR-RWP 204
            .:|.:       .|..:|.||     ..:..:::...||.|||::.:.:.::::.|:|:.| .| 
  Rat   170 INCSE-------GYIQNYRCR-----GEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTW- 221

  Fly   205 LRGS-LLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGA 248
             ||: ||.|:||...:.:|::..:|||.|||||.|||.||...||
  Rat   222 -RGARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSDVLAGFAQGA 265

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 55/155 (35%)