DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and Plpp1

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_032273.1 Gene:Plpp1 / 19012 MGIID:108412 Length:284 Species:Mus musculus


Alignment Length:262 Identity:97/262 - (37%)
Similarity:144/262 - (54%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FNLSLRPPIRLLVDLVLLGLLIVLVENFRRLWGPPTKRGFFCDDESLMYPYHENTVSPTLLHWLG 67
            |:.:..|.:.|.|..|||..:.:.:....:::  |.:|||||.|.|:.||||::|:...:|..||
Mouse     2 FDKTRLPYVALDVICVLLAAMPMTILKLGKVY--PFQRGFFCTDNSVKYPYHDSTIPSRILAILG 64

  Fly    68 LYLPLISLVVLESF-----LSHRKDMAPWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRP 127
            |.||:.|:.:.||.     :.|.......|.:..:|..|..||:|..::..|..|.|..:|.|||
Mouse    65 LGLPIFSMSIGESLSVYFNVLHSNSFVGNPYIATIYKAVGAFLFGVSASQSLTDIAKYTIGSLRP 129

  Fly   128 HFFAVCSPHFPDGS--SCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYG 190
            ||.|:|:   ||.|  :|.|       .|..||.|     |..||.:::..:||.||||:.:.|.
Mouse   130 HFLAICN---PDWSKINCSD-------GYIEDYIC-----QGNEEKVKEGRLSFYSGHSSFSMYC 179

  Fly   191 LVFVALHLRRRRWPLRGS---LLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSAL 252
            ::||||:|:.|   ::|.   ||.|:||...:|.:.:|.:|||.|||||||||..|.:.||..|:
Mouse   180 MLFVALYLQAR---MKGDWARLLRPMLQFGLIAFSIYVGLSRVSDYKHHWSDVTVGLIQGAAMAI 241

  Fly   253 AV 254
            .|
Mouse   242 LV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 66/164 (40%)
Plpp1NP_032273.1 PAP2_wunen 99..244 CDD:239479 66/163 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834751
Domainoid 1 1.000 47 1.000 Domainoid score I11956
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2766
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D434801at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.