DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11425 and plpp-1.3

DIOPT Version :9

Sequence 1:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_509790.2 Gene:plpp-1.3 / 181268 WormBaseID:WBGene00008749 Length:304 Species:Caenorhabditis elegans


Alignment Length:261 Identity:78/261 - (29%)
Similarity:118/261 - (45%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IRLLVDLVL-LGLLIVLVENFRRLWGP-----PTKRGFFCDDESLMYPYHENTVSPTLLHWLGLY 69
            |.:.:|:|: ||:...|.     ||..     |.:|...|.|.|:..|:.||||.  |.|.|.:.
 Worm    36 IYMALDIVIVLGISCSLF-----LWFSGSGINPYERAMPCGDISIQQPFKENTVG--LKHLLVIT 93

  Fly    70 L--PLISLVVLESFLSHRKD-----MAPWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRP 127
            |  |.:.:.::|:.| |.|.     :|.:.:...:  |...:|..|.:........|..:|||||
 Worm    94 LGSPFLIVALVEAIL-HFKSKGSNRLAKFFSATTI--TYLKYLLMYAACTFAMEFLKCYVGRLRP 155

  Fly   128 HFFAVCSPHF-----PDGSSCLDESHRGALKYHTDYEC-RPNLSQATEEMIRDVNVSFPSGHSAM 186
            |||:||.|.:     .|..|.:|.|         |..| .||     ...||....||||||:|.
 Worm   156 HFFSVCKPDWSKVDCTDKQSFIDSS---------DLVCTNPN-----PRKIRTARTSFPSGHTAA 206

  Fly   187 AFYGLVFVALHLRRRRWPLRGSLLSPVLQLACVAL----AW--FVAISRVIDYKHHWSDVAAGSL 245
            ||:..:||.::|||.   ...:.:..::.:..:.:    .|  |.|::||.|..|..:||..|.:
 Worm   207 AFHVFLFVYIYLRRM---AENTGIKEIITIRNILVPSYALWTVFCAVTRVTDNWHFPTDVLGGVI 268

  Fly   246 L 246
            |
 Worm   269 L 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 50/163 (31%)
plpp-1.3NP_509790.2 PAP2_like 73..280 CDD:382032 66/219 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.